PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG023630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 380aa    MW: 42951.6 Da    PI: 6.4437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG023630.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
      CCG023630.1 14 RGLWTPEEDAKILAYVSNHGIGNWTSVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding49.41e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+ +eE+el+++++k  G++ W++Ia++++ gRt++++k++w++
      CCG023630.1  69 RFAPEEEELIIKLHKAIGSR-WSLIAKKLP-GRTDNDVKNYWNT 110
                      889*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24563IPR009057Homeodomain-like
PROSITE profilePS5129425.781965IPR017930Myb domain
SuperFamilySSF466892.06E-3011108IPR009057Homeodomain-like
SMARTSM007177.4E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001676.30E-111761No hitNo description
Gene3DG3DSA:1.10.10.607.2E-2464116IPR009057Homeodomain-like
SMARTSM007172.1E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129417.87266116IPR017930Myb domain
PfamPF002499.4E-1469110IPR001005SANT/Myb domain
CDDcd001675.76E-1172112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVS NHGIGNWTSV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHERF APEEEELIIK LHKAIGSRWS LIAKKLPGRT DNDVKNYWNT KLRKMLQKMG  120
IDPVTHKPFS QIFSDFGNIR GISNTGNLNK SLNTSLMSEP DHQFSSAILT TTEHSSFKKT  180
MEEQVQEYNP TVTHPTSWDF LAHFPVHDTK QLPLFFNEVS SSCPSSSPSS SSTSTFTQSY  240
SCQKSQAPFI TPTCTFTWTE FLLSDPVLST EFQHQQEQYD FDEMLSPTNS STMARAQNDV  300
SSCNITSTGS DDDWYLNRSV GRSTYDHGTV NNGLEENNNA ADHAAYYSSS ASSFVDGILD  360
KDRELHSQFP PLLDPSFDYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141147106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008372.10.0PREDICTED: myb-related protein 330
TrEMBLB9IJQ40.0B9IJQ4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s11140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-87MYB family protein